Ãû³Æ | Tumor necrosis factor ligand superfamily member 12 Protein |
´¿¶È | >90% |
ËÞÖ÷ϸ°û | ExpiCHO |
ÐòÁÐ | MAARRSQRRRGRRGEPGTALLAPLVLSLGLALACLGLLLVVVSLGSWATLSAQEPSQEELTAEDRREPPELNPQTEESQDVVPFLEQLVRPRRSAPKGRKARPRRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLVNGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH |
»ùÒòÃû | Tnfsf12 |
Uniprot ID | O54907 |
ÎïÖÖ | Mus musculus(Mouse) |
²úÆ·ÐÔ×´ | Liquid |
»º³åÒº | 1¡ÁPBS£¬5% Glycerol£¬pH7.4 |
´¢´æ·½Ê½ | -80 ¡æ packaging and storage to avoid repeated freezing and thawing. |
SDS-PAGE &WB |
![]() |
Binds to FN14 and possibly also to TNRFSF12/APO3. Weak inducer of apoptosis in some cell types. Mediates NF-kappa-B activation. Promotes angiogenesis and the proliferation of endothelial cells. Also involved in induction of inflammatory cytokines. Promotes IL8 secretion (By similarity).