Ãû³Æ | Artemin Protein |
´¿¶È | >90% |
ËÞÖ÷ϸ°û | HEK293 |
ÐòÁÐ | MELGLGGLSTLSHCPWPRQQPALWPTLAALALLSSVAEASLGSAPRSPAPREGPPPVLASPAGHLPGGRTARWCSGRARRPPPQPSRPAPPPPAPPSALPRGGRAARAGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG |
»ùÒòÃû | ARTN |
Uniprot ID | Q5T4W7 |
ÎïÖÖ | Homo sapiens(Human) |
²úÆ·ÐÔ×´ | Liquid |
»º³åÒº | 1¡ÁPBS£¬pH7.4 |
´¢´æ·½Ê½ | -80 ¡æ packaging and storage to avoid repeated freezing and thawing. |
SDS-PAGE &WB |
![]() |
Growth factor that supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain (PubMed:10583383, PubMed:9883723). Acts by binding to its coreceptor, GFRA3, leading to autophosphorylation and activation of the RET receptor (PubMed:31535977). Strong attractant of gut hematopoietic cells thus promoting the formation Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue (By similarity).